Dengue Virus Envelope ST1 Recombinant (Cat. #PRP-005)
Specificity & Preparation: The E. coli-derived recombinant 23 kDa protein is a genetically engineered peptide corresponding to dengue type-1 N-terminus envelope immunodeterminant regions. This region also contains a common antigen for dengue virus types 1, 2 and 3. The protein is purified by proprietary chromatographic technique. Purity is >95% as determined by PAGE followed by coomassie staining. Sequence: TEAKQPATLRKYCIEAKLTNTTTDSRCPTQGEPSLNEEQDKRFVCKHSMVDRGWGNGC GLFGKGGIVTCAMFTCKKNMKGKVVQPENLEYTIVITPHSGEEHAVGNDTGKHGKEIKI TPQSSITEAELTGYGTVTMECSPRTGLDFNEMVLLQMENKAWLVHRQWFLDLPLPWLP GADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFT GHLKCRLRMDKLQLKG
Related Products: Dengue-2 Virus Envelope Mouse Monoclonal, Cat. #AB-437; Dengue Virus Envelope ST2 D-III Recombinant, Cat. #PRP-006; Dengue Virus Envelope ST2 Recombinant, Cat. #PRP-007; Dengue Virus Envelope ST3 Recombinant, Cat. #PRP-008; Dengue Virus Envelope ST4 Recombinant, Cat. #PRP-009; Dengue Virus Envelope ST3 D-III Recombinant, Cat. #PRP-013; , Cat. #PRP-401; Dengue-2 Virus NS1c Recombinant, Cat. #PRP-402; Dengue-2 Virus NS1n Recombinant, Cat. #PRP-403; Dengue Virus NS1 Recombinant, Cat. #PRP-404; Dengue Polyvalent Antigen Recombinant, Cat. #PRP-410; , Cat. #PR;
Data Sheet | Protocol(s) | Order Online
Please select the button below for Cat. #PRP-005 Pricing in your currency.
You have no items in your shopping cart
