Product Information

   
   
ATS Advanced
Targeting
Systems
10451 Roselle Street, #300
San Diego, CA 92121 USA

Tollfree: (877) 889-2288
Phone: (858) 642-1988
Fax: (858) 642-1989
 

Dengue Virus Envelope ST1 Recombinant (Cat. #PRP-005)

Specificity & Preparation: The E. coli-derived recombinant 23 kDa protein is a genetically engineered peptide corresponding to dengue type-1 N-terminus envelope immunodeterminant regions. This region also contains a common antigen for dengue virus types 1, 2 and 3. The protein is purified by proprietary chromatographic technique. Purity is >95% as determined by PAGE followed by coomassie staining. Sequence: TEAKQPATLRKYCIEAKLTNTTTDSRCPTQGEPSLNEEQDKRFVCKHSMVDRGWGNGC GLFGKGGIVTCAMFTCKKNMKGKVVQPENLEYTIVITPHSGEEHAVGNDTGKHGKEIKI TPQSSITEAELTGYGTVTMECSPRTGLDFNEMVLLQMENKAWLVHRQWFLDLPLPWLP GADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFT GHLKCRLRMDKLQLKG

Related Products: Dengue-2 Virus Envelope Mouse Monoclonal, Cat. #AB-437Dengue Virus Envelope ST2 D-III Recombinant, Cat. #PRP-006Dengue Virus Envelope ST2 Recombinant, Cat. #PRP-007Dengue Virus Envelope ST3 Recombinant, Cat. #PRP-008Dengue Virus Envelope ST4 Recombinant, Cat. #PRP-009Dengue Virus Envelope ST3 D-III Recombinant, Cat. #PRP-013, Cat. #PRP-401Dengue-2 Virus NS1c Recombinant, Cat. #PRP-402Dengue-2 Virus NS1n Recombinant, Cat. #PRP-403Dengue Virus NS1 Recombinant, Cat. #PRP-404Dengue Polyvalent Antigen Recombinant, Cat. #PRP-410, Cat. #PR

 

Data Sheet  | Protocol(s) | Order Online

Please select the button below for Cat. #PRP-005 Pricing in your currency.

USD     EURO     GBP

You have no items in your shopping cart

  ideal city
Home | About | Tutorial | Catalog | News | References | Ordering | Search | Contact
ADVANCED TARGETING SYSTEMS